• Assay Kits
  • Biology Cells
  • cDNA
  • Culture Cells
  • Clia Kits
  • Devices
  • DNA
  • DNA Templates
  • Enzymes
  • Equipments
  • Exosomes
  • Gels
  • Isotypes
  • Peptides
  • Reagents
  • Recombinant Proteins
  • Ria Kits
  • Test Kits
  • Pcr Kits
  • Particles
  • Panel
  • Western Blot
  • rna definition
  • rna fish
  • rna meaning
  • rna polymerase
  • rna primer
  • rna structure
  • rna vaccine
  • rna vaccine wiki
  • rna velocity
  • rna viruses
  • rnascope
  • rnai
  • rnation login
  • test kits cdc
  • Gender differences in the antioxidant response of oral administration of hydroxytyrosol and oleuropein against N-ethyl-N-nitrosourea (ENU)-induced glioma
  • SIRF: A Single-cell Assay for in situ Protein Interaction with Nascent DNA Replication Forks
  • Atomic Force Microscopy to Identify Dehydration Temperatures for Small Volumes of Active Pharmaceutical Ingredients.
  • Paper-Based Electrochemical Devices for the Pharmaceutical Field: State of the Art and Perspectives.
  • Contact us

Cowie Tech Laboratory, Pharmaceutical, Process Chemistry, Bio-Chem

Cowie Tech Laboratory, Pharmaceutical, Process Chemistry, Bio-Chem

  • Assay Kits
  • Biology Cells
  • cDNA
  • Culture Cells
  • Clia Kits
  • Devices
  • DNA
  • DNA Templates
  • Enzymes
  • Equipments
  • Exosomes
  • Gels
  • Isotypes
  • Peptides
  • Reagents
  • Recombinant Proteins
  • Ria Kits
  • Test Kits
  • Pcr Kits
  • Particles
  • Panel
  • Western Blot
  • rna definition
  • rna fish
  • rna meaning
  • rna polymerase
  • rna primer
  • rna structure
  • rna vaccine
  • rna vaccine wiki
  • rna velocity
  • rna viruses
  • rnascope
  • rnai
  • rnation login
  • test kits cdc
  • Gender differences in the antioxidant response of oral administration of hydroxytyrosol and oleuropein against N-ethyl-N-nitrosourea (ENU)-induced glioma
  • SIRF: A Single-cell Assay for in situ Protein Interaction with Nascent DNA Replication Forks
  • Atomic Force Microscopy to Identify Dehydration Temperatures for Small Volumes of Active Pharmaceutical Ingredients.
  • Paper-Based Electrochemical Devices for the Pharmaceutical Field: State of the Art and Perspectives.
  • Contact us
Cavity frequency-dependent theory for vibrational polariton chemistry

Cavity frequency-dependent theory for vibrational polariton chemistry

April 7, 2021 Antibodies Application of montmorillonite in bentonite as a pharmaceutical excipient in drug delivery systems. Assay Kits Atomic Force Microscopy to Identify Dehydration Temperatures for Small Volumes of Active Pharmaceutical Ingredients. Biology Cells cDNA Clia Kits Culture Cells Devices DNA DNA Templates DNA Testing Elisa Kits Enzymes Equipments Exosomes Gels Isotypes Medium & Serums My Blog NATtrol Panel Paper-Based Electrochemical Devices for the Pharmaceutical Field: State of the Art and Perspectives. Particles Pcr Kits Peptides Reagents Recombinant Proteins Ria Kits Test Kits

Recent experiments show the management of chemical reactivities by coupling molecules inside an optical microcavity. In distinction, transition state theory predicts no change of the response barrier top throughout this course of. Here, we current a theoretical rationalization of the cavity modification of the bottom state reactivity within the vibrational robust coupling (VSC) regime in polariton chemistry. Our theoretical outcomes recommend that the VSC kinetics modification is originated from the non-Markovian dynamics of the cavity radiation mode that {couples} to the molecule, resulting in the dynamical caging impact of the response coordinate and the suppression of response charge fixed for a particular vary of photon frequency near the barrier frequency.

We use a easy analytical non-Markovian charge theory to explain a single molecular system coupled to a cavity mode. We show the accuracy of the speed theory by performing direct numerical calculations of the transmission coefficients with the identical mannequin of the molecule-cavity hybrid system. Our simulations and analytical theory present a believable rationalization of the photon frequency dependent modification of the chemical reactivities within the VSC polariton chemistry.

The impossibility of experiencing the molecular world with our senses hampers instructing and understanding chemistry as a result of very summary ideas (resembling atoms, chemical bonds, molecular construction, reactivity) are required for this course of. Virtual actuality, particularly when based mostly on express bodily modeling (probably in actual time), gives an answer to this dilemma. Chemistry instructing could make use of superior applied sciences resembling virtual-reality frameworks and haptic units.

We present how an immersive studying setting may very well be utilized to assist college students perceive the core ideas of typical chemical reactions by providing a way more intuitive method than conventional studying settings. Our setting depends on an interactive exploration and manipulation of a chemical system; this method is simulated in real-time with quantum chemical strategies, and subsequently, behaves in a bodily significant manner.

Simulation of the consequences of forest harvesting beneath altering local weather to tell long-term sustainable forest administration utilizing a biogeochemical mannequin

Process ecosystem fashions are helpful instruments to offer perception on advanced, dynamic ecological methods, and their response to disturbances. The biogeochemical mannequin PnET-BGC was modified and examined utilizing subject observations from an experimentally whole-tree harvested northern hardwood watershed (W5) on the Hubbard Brook Experimental Forest (HBEF), New Hampshire, USA. Modelling of the Cascadia and Kyushu subduction zones reveals that the merchandise of sediment melting carefully reproduce the magnetotelluric observations.

In this research, the confirmed mannequin was used as a heuristic device to analyze long-term adjustments in hydrology, biomass accumulation, and soil resolution and stream water chemistry for three completely different watershed slicing intensities and three rotation lengths beneath each fixed (present local weather) and altering future local weather situations and atmospheric CO2 via the yr 2200. For the no future slicing situation, complete ecosystem saved carbon (i.e., sum of aboveground biomass, woody particles and soil) reached a most worth of 207 t C ha-1 beneath fixed local weather however elevated to 452 t C ha-1 beneath altering local weather in 2200 as a consequence of a CO2 fertilization impact.

Harvesting of timber decreased complete ecosystem saved carbon between 7 and 36% for fixed local weather and 7-60% beneath altering local weather, respectively, with better reductions for shorter logging rotation lengths and better watershed slicing intensities. Harvesting beneath local weather change resulted in noticeable losses of soil natural matter (12-56%) coinciding with lack of soil vitamins primarily as a consequence of increased charges of soil mineralization related to will increase in temperature, in contrast with fixed local weather situations.

Cumulative stream leaching of nitrate beneath local weather change exceeded fixed local weather values  for the varied slicing regimes. Under each local weather situations the mannequin projected better sensitivity to various the size of slicing interval than slicing intensities. Hypothetical mannequin simulations spotlight future challenges in sustaining long-term productiveness of managed forests beneath altering local weather as a consequence of a possible for a deterioration of soil fertility.

Cavity frequency-dependent theory for vibrational polariton chemistry

Melting of subducted sediments reconciles geophysical pictures of subduction zones

Sediments play a key function in subduction. They assist management the chemistry of arc volcanoes and the placement of seismic hazards. Here, we current a brand new mannequin describing the destiny of subducted sediments that explains magnetotelluric fashions of subduction zones, which generally present an enigmatic conductive anomaly on the trenchward aspect of volcanic arcs. In many subduction zones, sediments will soften trenchward of the supply area for arc melts. High-pressure experiments present that these sediment melts will react with the overlying mantle wedge to supply electrically conductive phlogopite pyroxenites.

Anti Equine TNF Alpha Mab [6H4.E1]

401042 Antibody Research Corporation 100 µg Ask for price

Equine IFN alpha 1 Recombinant Protein

R09608-3 BosterBio 5ug/vial
EUR 310.8
Description: IFN alpha is a mammalian Type I inferferon, mainly involved in innate immune response against viral infection. Equine IFN alpha 1 Recombinant Protein is purified IFN alpha produced in yeast.

Equine IL-1 alpha Recombinant Protein

R01144-3 BosterBio 5ug/vial
EUR 310.8
Description: IL-1 alpha (IL-1α, IL-1F1) is a member of the interleukin 1 family of cytokines. IL-1 alpha is an inflammatory cytokine active in the initiation of the inflammatory reaction and in driving Th1 and Th17 inflammatory responses. Equine IL-1 alpha Recombinant Protein is purified interleukin-1 alpha cytokine produced in yeast.

Recombinant Equine Interleukin 1 Alpha (IL1a)

AP7F91 BioVenic
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • 1 mg
  • 10 µg
  • 200 µg
  • 5 mg
  • 50 µg

Recombinant Equine Interferon Alpha-1 , N-His

AP9C974 BioVenic
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • 1 mg
  • 10 µg
  • 200 µg
  • 5 mg
  • 50 µg

Recombinant Equine Tumor Necrosis Factor Alpha (TNFA), N-His

AP7F48 BioVenic
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • 1 mg
  • 10 µg
  • 200 µg
  • 5 mg
  • 50 µg

Genorise® Recombinant Equine IFN alpha protein

GR104329 Genorise Scientific 5 µg
EUR 285

Recombinant Equine Interferon Alpha (IFNa), N-His

AP7F88 BioVenic
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • 1 mg
  • 10 µg
  • 200 µg
  • 5 mg
  • 50 µg

Recombinant (HEK) Hemagglutinin Influenza A Virus H3N8 (A/equine/Gansu/7/2008) HA protein (1-344, His-tag, >95%)

RP-1625 Alpha Diagnostics 10 ug
EUR 416.4

Recombinant Equine Hemoglobin Subunit Alpha (HBA), N-His

AP7F79 BioVenic
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • 1 mg
  • 10 µg
  • 200 µg
  • 5 mg
  • 50 µg

Recombinant Equine Tumor Necrosis Factor (TNF), N-His

AP9F61 BioVenic
  • Ask for price
  • Ask for price
  • Ask for price
  • 1 mg
  • 100 µg
  • 50 µg

Equine TNF-alpha ELISA Kit

NR-E10030 Novatein Biosciences, Inc.
  • Ask for price
  • Ask for price
  • Ask for price
  • 96 Tests
  • 2x 96 Tests
  • 4x 96 Tests

Recombinant Equine Interleukin-12 Subunit Alpha (IL12A), N-His

AP9C676 BioVenic
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • 1 mg
  • 10 µg
  • 200 µg
  • 5 mg
  • 50 µg

Butyrylcholine esterase (7U/mg), Equine Serum

BCE-02 Alpha Diagnostics 5 mU
EUR 562.8

Butyrylcholine esterase (50U/mg), Equine Serum

BCE-01 Alpha Diagnostics 5 mU
EUR 634.8

Horse IgA (Equine, control, non-immune), purified

20019-3-100 Alpha Diagnostics 100 ug
EUR 343.2

Recombinant Equine CCL11

CCL11-138E Creative BioMart 25ug
EUR 318.4
Description: Stable for up to twelve months from date of receipt at -20°C. Stable for at least 3 months when stored in working aliquots with a carrier protein at -20°C. Avoid repeated freeze/thaw cycles.

Horse IgM (Equine, Whole IgM, control, non-immune), purified

20019-2 Alpha Diagnostics 100 ug
EUR 196.8

SAA Equine Recombinant

MBS313582-01mg MyBiosource 0.1mg
EUR 1175

SAA Equine Recombinant

MBS313582-5x01mg MyBiosource 5x0.1mg
EUR 5115

Recombinant Equine herpesvirus 1 Alpha trans-inducing factor 82 kDa protein (14), partial

MBS1123432-INQUIRE MyBiosource INQUIRE Ask for price

Recombinant Equine herpesvirus 1 Alpha trans-inducing factor 82 kDa protein (14), partial

MBS1323403-INQUIRE MyBiosource INQUIRE Ask for price

Recombinant Equine herpesvirus 4 Alpha trans-inducing factor 82 kDa protein (14), partial

MBS1060673-INQUIRE MyBiosource INQUIRE Ask for price

Equine TNF-α ELISA Kit

T106004 101Bio 1 x 96-well
EUR 569

Horse IgG (Equine, Whole IgG, control, non-immune)-HRP Conjugate

20019-HP Alpha Diagnostics 0.5 mg
EUR 242.4

Horse IgG (Equine, Whole IgG, control, non-immune)-FITC Conjugate

20019-F Alpha Diagnostics 0.5 mg
EUR 242.4

Recombinant Equine IFN-γ

QEIFP-0101 Cyagen 100ug Ask for price

Recombinant Equine IL-1β

QEILP-0101 Cyagen 10ug Ask for price

Recombinant Equine IL-1β

P6470-100μg Beyotime Biotech Inc 100 µg Ask for price

Recombinant Equine IL-1β

P6470-10μg Beyotime Biotech Inc 10 µg Ask for price

Recombinant Equine IL-1β

P6470-500μg Beyotime Biotech Inc 500 µg Ask for price

Recombinant Equine IFN-γ

P6483-100μg Beyotime Biotech Inc 100 µg Ask for price

Recombinant Equine IFN-γ

P6483-500μg Beyotime Biotech Inc 500 µg Ask for price

Recombinant Equine IL-1RA

QEILP-0102 Cyagen 5ug Ask for price

Recombinant Equine IL-1RA

P6474-100μg Beyotime Biotech Inc 100 µg Ask for price

Recombinant Equine IL-1RA

P6474-500μg Beyotime Biotech Inc 500 µg Ask for price

Recombinant Equine IL-1RA

P6474-5μg Beyotime Biotech Inc 5 μg Ask for price

Horse IgM (Equine, Whole IgM, control, non-immune)-biotinylated, purified

20019-2-B Alpha Diagnostics 100 ug
EUR 242.4

Horse IgG (Equine, Whole IgG, control, non-immune)-biotinylated, purified

20019-B Alpha Diagnostics 0.5 mg
EUR 196.8

Recombinant Equine Leptin (LEP)

AP7F514 BioVenic 100 µg Ask for price

Horse IgG Fab fragment (Equine, Whole IgG, control, non-immune), purified

20019-1-Fab Alpha Diagnostics 0.5 mg
EUR 196.8

Horse IgG Fab2 fragment (Equine, Whole IgG, control, non-immune), purified

20019-1-Fab2 Alpha Diagnostics 0.5 mg
EUR 196.8

Nori® Equine TNF-alpha POCT Systems-25 Tests

GR223023 Genorise Scientific 25 Tests
EUR 618

Recombinant (E.Coli) Human p38 alpha/SAPK2 alpha

RP-675 Alpha Diagnostics 1 ug
EUR 343.2

Recombinant Equine IL28B Protein

IL28B-4370E Creative BioMart 5 µg
EUR 398.4
Description: Store at -20 centigrade.

Recombinant Equine KITLG Protein

KITLG-4392E Creative BioMart 100 µg
EUR 1498.4
Description: Store at -20 centigrade.

Recombinant Equine PDGFB Protein

PDGFB-4410E Creative BioMart 25 µg
EUR 374.4
Description: Store at -20 centigrade.

Equine CCL3 Recombinant Protei

R00405-1 BosterBio 5ug/vial
EUR 310.8
Description: Chemokine ligand 3 (CCL3), also known as Macrophage Inflammatory Protein-1 alpha (MIP-1 alpha), is a small cytokine belonging to the CC chemokine family. CCL3 (MIP-1 alpha) is a chemoattractant for several different leukocytes, with varying degrees of potency. Equine CCL3 Recombinant Protein is purified chemokine ligand 3 (CCL3, MIP-1 alpha) produced in yeast.

Equine EPO Recombinant Protein

R00484-1 BosterBio 5ug/vial
EUR 310.8
Description: Erythropoietin (EPO) is an essential hormone for red blood cell production. Erythropoietin has a range of actions including vasoconstriction-dependent hypertension, stimulating angiogenesis, and inducing proliferation of smooth muscle fibers. Equine Erythropoietin Recombinant Protein is purified Erythropoietin (EPO) produced in yeast.

Equine CCL5 Recombinant Protei

R00617-2 BosterBio 5ug/vial
EUR 310.8
Description: CCL5, also known as RANTES (regulated and normal T cell expressed and secreted), is a member of the C-C Chemokine Family. RANTES (CCL5) is chemotactic for T cells, eosinophils, and basophils, and plays an active role in recruiting leukocytes into inflammatory sites. Equine CCL5 Recombinant Protein is purified CCL5 (RANTES) produced in yeast.

Recombinant Equine Interleukin-2

cyt-738-1mg ProSpec Tany 1mg
EUR 2700

Recombinant Equine Interleukin-2

cyt-738-20g ProSpec Tany 20µg
EUR 145

Recombinant Equine Interleukin-2

cyt-738-5g ProSpec Tany 5µg
EUR 60

Recombinant Equine Interleukin-2

MBS145623-0005mg MyBiosource 0.005mg
EUR 240

Recombinant Equine Interleukin-2

MBS145623-002mg MyBiosource 0.02mg
EUR 310

Recombinant Equine Interleukin-2

MBS145623-1mg MyBiosource 1mg
EUR 2880

Recombinant Equine Interleukin-2

MBS145623-5x1mg MyBiosource 5x1mg
EUR 12630

Equine CCL2 Recombinant Protein

R00056-2 BosterBio 5ug/vial
EUR 310.8
Description: Chemokine (C-C motif) ligand 2 (CCL2), also known as monocyte chemotactic protein-1 (MCP-1), is a small cytokine belonging to the CC chemokine family. CCL2 (MCP-1) recruits monocytes, memory T cells, and dendritic cells to sites of tissue injury and infection. Equine CCL2 (MCP-1) Recombinant Protein is purified CCL2 (MCP-1) produced in yeast.

Equine CXCL9 Recombinant Protein

R01397-1 BosterBio 5ug/vial
EUR 310.8
Description: CXCL9 (MIG) is a T-cell chemoattractant. Induced by IFN-gamma (IFN-γ), the ELR-negative chemokine CXCL9 (MIG) elicits its effects by binding to the cell surface chemokine receptor CXCR3. Equine CXCL9 Recombinant Protein is purified CXCL9 (MIG) produced in yeast.

Equine CCL11 Recombinant Protein

R01438-1 BosterBio 5ug/vial
EUR 310.8
Description: Chemokine ligand 11 (CCL11) belongs to the CC chemokine family and is commonly known as Eotaxin-1. CCL11 (Eotaxin-1) selectively recruits eosinophils by inducing their chemotaxis, and therefore, is implicated in allergic responses. Equine CCL11 Recombinant Protein is purified chemokine ligand 11 (CCL11, Eotaxin-1) produced in yeast.

Anti Equine TNF-a Mab [12F6]

401055 Antibody Research Corporation 100 µg Ask for price

Equine CXCL10 Recombinant Protein

R00278-2 BosterBio 5ug/vial
EUR 310.8
Description: The ELR-negative CXC chemokine CXCL10 (IP-10) has been attributed to several roles, such as chemoattraction for monocytes/macrophages, T cells, NK cells, and dendritic cells, promotion of T cell adhesion to endothelial cells, antitumor activity, and inhibition of bone marrow colony formation and angiogenesis. Equine CXCL10 Recombinant Protein is purified CXCL10 (IP-10) produced in yeast.

Recombinant Equine Interferon-gamma

cyt-739-1mg ProSpec Tany 1mg
EUR 2700

Recombinant Equine Interferon-gamma

cyt-739-20g ProSpec Tany 20µg
EUR 145

Recombinant Equine Interferon-gamma

cyt-739-5g ProSpec Tany 5µg
EUR 60

Recombinant Equine Interferon-gamma

AP60276 SAB 500ug
EUR 885

Recombinant Equine Interferon-gamma

MBS146001-0005mg MyBiosource 0.005mg
EUR 240

Recombinant Equine Interferon-gamma

MBS146001-002mg MyBiosource 0.02mg
EUR 310

Recombinant Equine Interferon-gamma

MBS146001-1mg MyBiosource 1mg
EUR 2880

Recombinant Equine Interferon-gamma

MBS146001-5x1mg MyBiosource 5x1mg
EUR 12630

Recombinant Equine Interferon-gamma

P1397-.1 ApexBio 100ug
EUR 396
Description: Peptides & Proteins|Recombinant Proteins

Recombinant Equine Interferon-gamma

P1397-.5 ApexBio 500ug
EUR 888.8
Description: Peptides & Proteins|Recombinant Proteins

Interleukin-2 Equine Recombinant

rAP-0649 Angio Proteomie Inquiry Ask for price

Genorise® Recombinant Equine HGF

GR104207 Genorise Scientific 5 µg
EUR 285

Genorise® Recombinant Equine BNP

GR104274 Genorise Scientific 5 µg
EUR 285

Recombinant Equine IL-2 Cys141Ser

QEILP-0201 Cyagen 10ug Ask for price

Genorise® Recombinant equine TLR1

GR104008 Genorise Scientific 5 µg
EUR 285

Genorise® Recombinant equine TLR2

GR104009 Genorise Scientific 5 µg
EUR 285

Genorise® Recombinant equine TLR3

GR104010 Genorise Scientific 5 µg
EUR 285

Genorise® Recombinant equine TLR5

GR104011 Genorise Scientific 5 µg
EUR 285

Genorise® Recombinant equine TLR7

GR104012 Genorise Scientific 5 µg
EUR 285

Genorise® Recombinant equine TLR9

GR104013 Genorise Scientific 5 µg
EUR 285

Genorise® Recombinant Equine VEGF

GR104209 Genorise Scientific 5 µg
EUR 285

Genorise® Recombinant Equine cTnT

GR104288 Genorise Scientific 5 µg
EUR 285

Genorise® Recombinant Equine cTnI

GR104289 Genorise Scientific 5 µg
EUR 285

Recombinant Equine IL-2 Cys141Ser

P6479-100μg Beyotime Biotech Inc 100 µg Ask for price

Recombinant Equine IL-2 Cys141Ser

P6479-10μg Beyotime Biotech Inc 10 µg Ask for price

Recombinant Equine IL-2 Cys141Ser

P6479-500μg Beyotime Biotech Inc 500 µg Ask for price

Interferon-Gamma Equine Recombinant

rAP-0471 Angio Proteomie Inquiry Ask for price

Equine IL-5 Recombinant Protein

R01086-2 BosterBio 5ug/vial
EUR 310.8
Description: The IL-5 cytokine has a key role in regulating eosinophil development and is responsible for selective terminal differentiation of eosinophils. It is associated with the cause of several allergic diseases including allergic rhinitis and asthma. Equine IL-5 Recombinant Protein is purified interleukin-5 produced in yeast.

Equine IL-13 Recombinant Protei

R00077-3 BosterBio 5ug/vial
EUR 310.8
Description: IL-13 is an important mediator of allergic inflammation and disease. In addition to effects on immune cells, IL-13 is implicated as a central mediator of the physiologic changes induced by allergic inflammation in many tissues. Equine IL-13 Recombinant Protein is purified interleukin-13 produced in yeast.

Equine IL-6 Recombinant Protein

R00102-3 BosterBio 5ug/vial
EUR 310.8
Description: Interleukin-6 (IL-6) is an interleukin that acts as both a pro-inflammatory and anti-inflammatory cytokine. Equine IL-6 Recombinant Protein is purified interleukin-6 produced in yeast.

Equine IL-4 Recombinant Protein

R00230-3 BosterBio 5ug/vial
EUR 310.8
Description: IL-4 has many biological roles, including the stimulation of activated B-cell and T-cell proliferation, and the differentiation of CD4+ T-cells into Th2 cells. It is a key regulator in humoral and adaptive immunity. Equine IL-4 Recombinant Protein is purified interleukin-4 produced in yeast.

Equine IL-2 Recombinant Protein

R00387-3 BosterBio 5ug/vial
EUR 310.8
Description: Interleukin-2 (IL-2) is a cytokine produced by T-helper cells in response to antigenic or mitogenic stimulation. It is required for T-cell proliferation and other activities crucial to the regulation of the immune response. Equine IL-2 Recombinant Protein is purified interleukin-2 produced in yeast.

Equine IL-8 Recombinant Protein

R00423-5 BosterBio 5ug/vial
EUR 310.8
Description: Interleukin-8 (IL-8), also known as CXCL8, is an ELR-positive CXC family member chemokine produced by macrophages and other cell types such as epithelial cells. ELR-positive CXC chemokines such as IL-8 specifically induce the migration of neutrophils, and interact with chemokine receptors CXCR1 and CXCR2. Equine IL-8 Recombinant Protein is purified interleukin-8 produced in yeast.

Recombinant (E.Coli) purified human Tumor Necrosis Factor-Alpha (TNF-alpha), biologically active

TNFA15-R-10 Alpha Diagnostics 10 ug
EUR 270

Recombinant (E.Coli) purified rat Tumor Necrosis Factor-Alpha (TNF-alpha), biologically active

TNFA25-R-5 Alpha Diagnostics 5 ug
EUR 270

Recombinant (E.Coli) purified mouse Tumor Necrosis Factor-Alpha (TNF-alpha), biologically active

TNFA35-R-5 Alpha Diagnostics 5 ug
EUR 270

TNF ELISA Kit (Equine) (OKEH04796)

OKEH04796 Aviva Systems Biology 96 Wells
EUR 433.2
Description: Description of target: Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimulate cell proliferation and induce cell differentiation.The TNF intracellular domain (ICD) form induces IL12 production in dendritic cells.;Species reactivity: Equine;Application: ;Assay info: Assay Methodology: Quantitative Sandwich Immunoassay;Sensitivity:

Genorise® Recombinant Equine ProBNP

GR104275 Genorise Scientific 5 µg
EUR 285

Genorise® Recombinant Equine SLC2A1

GR104287 Genorise Scientific 5 µg
EUR 285

Equine IL-10 Recombinant Protein

R00021-2 BosterBio 5ug/vial
EUR 310.8
Description: IL-10 is an anti-inflammatory cytokine and a member of the IL-10 family of cytokines, which have indispensable functions in many infectious and inflammatory diseases. Equine IL-10 Recombinant Protein is purified interleukin-10 produced in yeast.

Equine IL-15 Recombinant Protein

R00212-1 BosterBio 5ug/vial
EUR 310.8
Description: Interleukin-15 (IL-15) is a cytokine with structural similarity to IL-2 that is secreted by mononuclear phagocytes following infection by virus(es). This cytokine induces cell proliferation of natural killer cells. Equine IL-15 Recombinant Protein is purified interleukin-15 produced in yeast.

Recombinant (E.Coli) purified porcine Tumor Necrosis Factor-Alpha (TNF-alpha), biologically active

TNFA36-R-5 Alpha Diagnostics 5 ug
EUR 270

Recombinant Human Alpha-Synuclein

RP-847 Alpha Diagnostics 20 ug
EUR 196.8

Recombinant Equine Interleukin-2 (IL2)

AP9C990 BioVenic
  • Ask for price
  • Ask for price
  • Ask for price
  • 10 µg
  • 100 µg
  • 500 µg

Recombinant Equine Interleukin-4 (IL4)

AP9C992 BioVenic
  • Ask for price
  • Ask for price
  • Ask for price
  • 10 µg
  • 100 µg
  • 500 µg

Recombinant Equine Neuregulin-1 (NRG1)

AP2F277 BioVenic 50 µg Ask for price

Equine VEGF-A Recombinant Protein

R00045-2 BosterBio 5ug/vial
EUR 310.8
Description: VEGF-A is member of the family of vascular endothelial growth factor (VEGF) proteins, which stimulate vasculogenesis and angiogenesis to restore oxygen supply to tissues. VEGF-A is also a vasodilator and increases microvascular permeability and was originally referred to as vascular permeability factor (VPF). Equine VEGF-A Recombinant Protein is purified vascular endothelial growth factor A produced in yeast.

Equine IL-17A Recombinant Protein

R00421-2 BosterBio 5ug/vial
EUR 310.8
Description: IL-17A is a member of the IL-17 family of cytokines, whose members are involved in numerous immune regulatory functions. IL-17 induces the production of many other cytokines, chemokines, and prostaglandins. Equine IL-17A Recombinant Protein is purified interleukin-17A produced in yeast.

Equine IL-1ra Recombinant Protein

R00651-4 BosterBio 5ug/vial
EUR 310.8
Description: Interleukin-1 Receptor Antagonist Protein (IL-1F3, IL-1ra) belongs to the IL-1 family of cytokines, whose members play key roles in the development and regulation of inflammation. IL-1 receptor antagonist (IL-1ra; IL-1F3) reduces inflammation by blocking the binding of the agonist receptor ligands. Equine IL-1 Receptor Antagonist Recombinant Protein is purified interleukin-1 receptor antagonist protein (IL-1F3, IL-1ra) produced in yeast.

Equine GM-CSF Recombinant Protein

R00911-3 BosterBio 5ug/vial
EUR 310.8
Description: Granulocyte-macrophage colony-stimulating factor (GM-CSF) is a protein secreted by macrophages, T cells, mast cells, NK cells, endothelial cells and fibroblasts. GM-CSF stimulates stem cells to produce granulocytes (neutrophils, eosinophils, and basophils) and monocytes. Equine GM-CSF Recombinant Protein is purified GM-CSF produced in yeast

Nori® Equine (horse) TNF-alpha ELISA Kit-Urine

GR106016 Genorise Scientific 96-well
EUR 461

Recombinant Equine Interleukin-1 beta

cyt-411-10g ProSpec Tany 10µg
EUR 145

Recombinant Equine Interleukin-1 beta

cyt-411-1mg ProSpec Tany 1mg
EUR 4680

Recombinant Equine Interleukin-1 beta

cyt-411-2g ProSpec Tany 2µg
EUR 60

Recombinant Equine Interleukin-1 beta

AP60273 SAB 100ug
EUR 1398

Recombinant Equine Interleukin-1 beta

MBS142287-0002mg MyBiosource 0.002mg
EUR 240

Recombinant Equine Interleukin-1 beta

MBS142287-001mg MyBiosource 0.01mg
EUR 310

Recombinant Equine Interleukin-1 beta

MBS142287-1mg MyBiosource 1mg
EUR 4895

Recombinant Equine Interleukin-1 beta

MBS142287-5x1mg MyBiosource 5x1mg
EUR 21695

Recombinant Equine Interleukin-1 beta

P1394-.01 ApexBio 10ug
EUR 272.8
Description: Peptides & Proteins|Recombinant Proteins

Recombinant Equine Interleukin-1 beta

P1394-.1 ApexBio 100ug
EUR 1405.6
Description: Peptides & Proteins|Recombinant Proteins

Recombinant Equine Interleukin-1 beta

P1394-.5 ApexBio 500ug
EUR 3152.8
Description: Peptides & Proteins|Recombinant Proteins

Equine IFN gamma Recombinant Protein

R00393-5 BosterBio 5ug/vial
EUR 310.8
Description: IFN-gamma, or type II interferon, is a cytokine that is critical for innate and adaptive immunity against viral and intracellular bacterial infections and for tumor control. Equine IFN gamma Recombinant Protein is purified IFN gamma produced in yeast.

Recombinant Equine Interferon Gamma (IFNG)

AP7F542 BioVenic 20 µg Ask for price

Recombinant Equine Interleukin-8 (CXCL8)

AP9C986 BioVenic
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • 1 mg
  • 10 µg
  • 200 µg
  • 5 mg
  • 50 µg

Recombinant Equine Interleukin-10 (IL10)

AP9C998 BioVenic
  • Ask for price
  • Ask for price
  • Ask for price
  • 10 µg
  • 100 µg
  • 500 µg

Recombinant Equine Neurotrophin-3 (NTF3)

AP2F288 BioVenic 50 µg Ask for price

Nori Equine TNF RI/TNFRSF1A ELISA Kit

GR106480 Genorise Scientific 96-well
EUR 461

Genorise® Recombinant equine IL-2

GR104002 Genorise Scientific 5 µg
EUR 285

Genorise® Recombinant equine IL-5

GR104003 Genorise Scientific 5 µg
EUR 285

Genorise® Recombinant equine IL-6

GR104004 Genorise Scientific 5 µg
EUR 285

Genorise® Recombinant equine IL-4

GR104151 Genorise Scientific 5 µg
EUR 285

Genorise® Recombinant Equine IL-8

GR104210 Genorise Scientific 5 µg
EUR 285

Recombinant Equine Leptin (LEP), N-His

AP9C985 BioVenic
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • 1 mg
  • 10 µg
  • 200 µg
  • 5 mg
  • 50 µg

Nori Equine TNF RII/TNFRSF1B ELISA Kit

GR106481 Genorise Scientific 96-well
EUR 461

Equine Tumor Necrosis Factor Alpha (TNFa) ELISA Kit

DLR-TNFa-Eq DL Develop 96T
EUR 448
Description: serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Equine Tumor Necrosis Factor Alpha (TNFa) ELISA Kit

DLR-TNFa-Eq-48T DL Develop 48T
EUR 603.6
Description: A sandwich quantitative ELISA assay kit for detection of Equine Tumor Necrosis Factor Alpha (TNFa) in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Equine Tumor Necrosis Factor Alpha (TNFa) ELISA Kit

DLR-TNFa-Eq-96T DL Develop 96T
EUR 784.8
Description: A sandwich quantitative ELISA assay kit for detection of Equine Tumor Necrosis Factor Alpha (TNFa) in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Equine Tumor Necrosis Factor Alpha (TNFa) ELISA Kit

DL-TNFa-Eq DL Develop 96T
EUR 427
Description: serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Equine Tumor Necrosis Factor Alpha (TNFa) ELISA Kit

EK16991 SAB 96Т
EUR 768

Equine Tumor Necrosis Factor Alpha (TNFa) ELISA Kit

MBS4502969-10x96Tests MyBiosource 10x96Tests
EUR 5115

Equine Tumor Necrosis Factor Alpha (TNFa) ELISA Kit

MBS4502969-48Tests MyBiosource 48Tests
EUR 445

Equine Tumor Necrosis Factor Alpha (TNFa) ELISA Kit

MBS4502969-5x96Tests MyBiosource 5x96Tests
EUR 2625

Equine Tumor Necrosis Factor Alpha (TNFa) ELISA Kit

MBS4502969-96Test MyBiosource 96Test
EUR 590

Equine Tumor Necrosis Factor Alpha (TNFa) ELISA Kit

RDR-TNFa-Eq-48T Reddot Biotech 48T
EUR 482
Description: sandwich

Equine Tumor Necrosis Factor Alpha (TNFa) ELISA Kit

RDR-TNFa-Eq-48Tests Reddot Biotech 48 Tests
EUR 633.6

Equine Tumor Necrosis Factor Alpha (TNFa) ELISA Kit

RDR-TNFa-Eq-96T Reddot Biotech 96T
EUR 689
Description: sandwich

Equine Tumor Necrosis Factor Alpha (TNFa) ELISA Kit

RDR-TNFa-Eq-96Tests Reddot Biotech 96 Tests
EUR 879.6

Equine Tumor Necrosis Factor Alpha (TNFa) ELISA Kit

RD-TNFa-Eq-48T Reddot Biotech 48T
EUR 459
Description: sandwich

Equine Tumor Necrosis Factor Alpha (TNFa) ELISA Kit

RD-TNFa-Eq-48Tests Reddot Biotech 48 Tests
EUR 606

Equine Tumor Necrosis Factor Alpha (TNFa) ELISA Kit

RD-TNFa-Eq-96T Reddot Biotech 96T
EUR 656
Description: sandwich

Equine Tumor Necrosis Factor Alpha (TNFa) ELISA Kit

RD-TNFa-Eq-96Tests Reddot Biotech 96 Tests
EUR 840

Genorise® Recombinant equine IL-1β

GR104001 Genorise Scientific 5 µg
EUR 285

Genorise® Recombinant equine IL-10

GR104005 Genorise Scientific 5 µg
EUR 285

Genorise® Recombinant equine IL-12

GR104006 Genorise Scientific 5 µg
EUR 285

Genorise® Recombinant equine IL-15

GR104007 Genorise Scientific 5 µg
EUR 285
×

Melting of subducted sediments may clarify Ok-rich volcanic rocks which might be produced when the phlogopite pyroxenites soften throughout slab roll-back occasions. This course of can also assist constrain fashions for subduction zone seismicity. Since melts and phlogopite each have low frictional power, damaging thrust earthquakes are unlikely to happen within the neighborhood of the melting sediments, whereas elevated fluid pressures might promote the prevalence of small magnitude earthquakes and episodic tremor and slip.

exosomes 5gexosomes and chfexosomes and coronavirusexosomes and edexosomes and msexosomes and raexosomes and virusesexosomes are virusexosomes dr kaufmanexosomes for deliveryexosomes for hairexosomes for hair lossexosomes mscexosomes njexosomes temexosomes therapyexosomes treatmentgels igagels iga st henry ohiogels kitchengelsemiumgelsemium homeopathicgelsemium sempervirensgelsenkirchengelsey kirklandgelsey kirkland 2020gelsolingelson’s instacartgelson’s marketgelson’s rancho miragegelson’s thousand oaksgelson’s weekly flyergelsosomo’s crown pointgelsosomo’s pizzagelsosomo’s pizza chestertongelston house east haddam ctgelstxgelsyn injectiongelsyn-3gelsyn-3 injectionisotopes and ionsisotopes baseballisotopes baseball abqisotopes definitionisotopes examplesisotopes of argonisotopes of copperisotopes of hydrogenisotopes of leadisotopes of nitrogenisotopes of oxygenisotopes of oxygen-16isotopes of rheniumisotopes of sulfurisotopes of uraniumisotopes of waterisotopes of xenonisotopes of ytterbiumisotopes that decay slowly are used to dateisotopes websiteisotypes bio meaningisotypes of antibodiesisotypes of antibodies and their functionisotypes of immunoglobulin

Cold plasma for mitigating agrochemical and pesticide residue in food and water: Similarities with ozone and ultraviolet technologies

The Future of Ligand Engineering in Colloidal Semiconductor Nanocrystals

Categories
  • Antibodies
  • Application of montmorillonite in bentonite as a pharmaceutical excipient in drug delivery systems.
  • Assay Kits
  • Atomic Force Microscopy to Identify Dehydration Temperatures for Small Volumes of Active Pharmaceutical Ingredients.
  • Biology Cells
  • Blog
  • cDNA
  • Clia Kits
  • Culture Cells
  • Devices
  • DNA
  • DNA Templates
  • DNA Testing
  • Elisa Kits
  • Enzymes
  • Equipments
  • Exosomes
  • Gels
  • Isotypes
  • Medium & Serums
  • My Blog
  • NATtrol
  • Panel
  • Paper-Based Electrochemical Devices for the Pharmaceutical Field: State of the Art and Perspectives.
  • Particles
  • Pcr Kits
  • Peptides
  • Reagents
  • Recombinant Proteins
  • Ria Kits
  • Test Kits
  • Western Blot
Recent Posts
  • (no title)
  • Transcription and Enhancers
  • Thymine Dimer
  • Lac Operon Induction in Escherichia coli
  • A Flash-Induced Robust Cu Electrode on Glass Substrates and Its Application for Thin-Film μLEDs
Tags
elisa kits china elisa kits companies elisa kits definition elisa kits distributor all over the world elisa kits distributor list elisa kits for chemokines gelsemium gelsemium homeopathic gelsemium sempervirens gelsenkirchen gelsey kirkland gelsey kirkland 2020 gels iga gels iga st henry ohio gels kitchen gelsolin gelson’s instacart gelson’s market gelson’s rancho mirage gelson’s thousand oaks gelson’s weekly flyer gelsosomo’s crown point gelsosomo’s pizza gelsosomo’s pizza chesterton gelston house east haddam ct gelstx gelsyn-3 gelsyn-3 injection gelsyn injection isotopes and ions isotopes baseball isotopes baseball abq isotopes definition isotopes examples isotopes of argon isotopes of copper isotopes of hydrogen isotopes of xenon isotopes of ytterbium isotopes that decay slowly are used to date isotopes website isotypes bio meaning isotypes of antibodies isotypes of antibodies and their function isotypes of immunoglobulin
September 2026
M T W T F S S
 123456
78910111213
14151617181920
21222324252627
282930  
« Oct    
Proudly powered by WordPress | Theme: Doo by ThemeVS.